Lineage for d2lyka_ (2lyk A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1488831Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1488832Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1488929Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 1488976Protein Putative transcription regulator CylR2 [109811] (1 species)
  7. 1488977Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries)
    Uniprot Q8VL32
  8. 1488984Domain d2lyka_: 2lyk A: [243039]
    automated match to d2xi8a_

Details for d2lyka_

PDB Entry: 2lyk (more details)

PDB Description: NOE-based 3D structure of the CylR2 homodimer at 270K (-3 Celsius degrees)
PDB Compounds: (A:) cylr2

SCOPe Domain Sequences for d2lyka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lyka_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe

SCOPe Domain Coordinates for d2lyka_:

Click to download the PDB-style file with coordinates for d2lyka_.
(The format of our PDB-style files is described here.)

Timeline for d2lyka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2lykb_