SCOPe 2.08: Domain d2lyjb_: 2lyj B:

Lineage for d2lyjb_ (2lyj B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Putative transcription regulator CylR2 [109811] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries)
   Uniprot Q8VL32

8. Domain d2lyjb_: 2lyj B: [243038]
   automated match to d2xi8a_

Details for d2lyjb_

PDB Entry: 2lyj

PDB Description: NOE-based 3D structure of the CylR2 homodimer at 298K

PDB Compounds: (B:) cylr2

SCOPe Domain Sequences for d2lyjb_:

Sequence; same for both SEQRES and ATOM records:

>d2lyjb_ a.35.1.3 (B:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe

Timeline for d2lyjb_:

• d2lyjb_ first appeared in SCOPe 2.04
  
• d2lyjb_ appears in SCOPe 2.07