Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
Protein Putative transcription regulator CylR2 [109811] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries) Uniprot Q8VL32 |
Domain d2lyjb_: 2lyj B: [243038] automated match to d2xi8a_ |
PDB Entry: 2lyj (more details)
SCOPe Domain Sequences for d2lyjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lyjb_ a.35.1.3 (B:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi fqwqpe
Timeline for d2lyjb_: