SCOPe 2.06: Domain d2lyja_: 2lyj A:

Lineage for d2lyja_ (2lyj A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Putative transcription regulator CylR2 [109811] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries)
   Uniprot Q8VL32

8. Domain d2lyja_: 2lyj A: [243037]
   automated match to d2xi8a_

Details for d2lyja_

PDB Entry: 2lyj

PDB Description: NOE-based 3D structure of the CylR2 homodimer at 298K

PDB Compounds: (A:) cylr2

SCOPe Domain Sequences for d2lyja_:

Sequence; same for both SEQRES and ATOM records:

>d2lyja_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe

Timeline for d2lyja_:

• d2lyja_ first appeared in SCOPe 2.04
  
• d2lyja_ appears in SCOPe 2.05
  
• d2lyja_ appears in SCOPe 2.07
  
• d2lyja_ appears in the current release, SCOPe 2.08