Lineage for d2lyaa_ (2lya A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716789Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 2716790Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 2716791Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
    automatically mapped to Pfam PF00540
  6. 2716825Protein automated matches [228657] (4 species)
    not a true protein
  7. 2716832Species Human immunodeficiency virus type 1 [TaxId:11698] [255469] (2 PDB entries)
  8. 2716834Domain d2lyaa_: 2lya A: [243035]
    automated match to d1upha_
    complexed with pc8

Details for d2lyaa_

PDB Entry: 2lya (more details)

PDB Description: Structure of HIV-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidylcholine
PDB Compounds: (A:) Matrix protein p17

SCOPe Domain Sequences for d2lyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lyaa_ a.61.1.1 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
tgnnsqvsqny

SCOPe Domain Coordinates for d2lyaa_:

Click to download the PDB-style file with coordinates for d2lyaa_.
(The format of our PDB-style files is described here.)

Timeline for d2lyaa_: