Lineage for d2ly4a_ (2ly4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2697958Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2698017Protein automated matches [190434] (3 species)
    not a true protein
  7. 2698026Species Human (Homo sapiens) [TaxId:9606] [187328] (5 PDB entries)
  8. 2698029Domain d2ly4a_: 2ly4 A: [243032]
    automated match to d1aaba_
    protein/DNA complex

Details for d2ly4a_

PDB Entry: 2ly4 (more details)

PDB Description: HMGB1-facilitated p53 DNA binding occurs via HMG-box/p53 transactivation domain interaction and is regulated by the acidic tail
PDB Compounds: (A:) High mobility group protein B1

SCOPe Domain Sequences for d2ly4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ly4a_ a.21.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkgdpkkprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakekgkfe
dmakadkaryeremktyippkge

SCOPe Domain Coordinates for d2ly4a_:

Click to download the PDB-style file with coordinates for d2ly4a_.
(The format of our PDB-style files is described here.)

Timeline for d2ly4a_: