SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ly4a_ (2ly4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986423Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1986424Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1986425Family a.21.1.1: HMG-box [47096] (10 protein domains)
  6. 1986482Protein automated matches [190434] (3 species)
    not a true protein
  7. 1986491Species Human (Homo sapiens) [TaxId:9606] [187328] (5 PDB entries)
  8. 1986494Domain d2ly4a_: 2ly4 A: [243032]
    automated match to d1aaba_
    protein/DNA complex

Details for d2ly4a_

PDB Entry: 2ly4 (more details)

PDB Description: HMGB1-facilitated p53 DNA binding occurs via HMG-box/p53 transactivation domain interaction and is regulated by the acidic tail
PDB Compounds: (A:) High mobility group protein B1

SCOPe Domain Sequences for d2ly4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ly4a_ a.21.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkgdpkkprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakekgkfe
dmakadkaryeremktyippkge

SCOPe Domain Coordinates for d2ly4a_:

Click to download the PDB-style file with coordinates for d2ly4a_.
(The format of our PDB-style files is described here.)

Timeline for d2ly4a_: