Class a: All alpha proteins [46456] (290 folds) |
Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (2 families) |
Family a.21.1.1: HMG-box [47096] (10 proteins) |
Protein automated matches [190434] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187328] (5 PDB entries) |
Domain d2ly4a_: 2ly4 A: [243032] automated match to d1aaba_ protein/DNA complex |
PDB Entry: 2ly4 (more details)
SCOPe Domain Sequences for d2ly4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ly4a_ a.21.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gkgdpkkprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakekgkfe dmakadkaryeremktyippkge
Timeline for d2ly4a_: