Lineage for d2lxxa_ (2lxx A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576507Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2576508Protein automated matches [190971] (14 species)
    not a true protein
  7. 2576575Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255468] (3 PDB entries)
  8. 2576576Domain d2lxxa_: 2lxx A: [243031]
    automated match to d4keea_

Details for d2lxxa_

PDB Entry: 2lxx (more details)

PDB Description: solution structure of cofilin like unc-60b protein from caenorhabditis elegans
PDB Compounds: (A:) Actin-depolymerizing factor 2, isoform c

SCOPe Domain Sequences for d2lxxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lxxa_ d.109.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
masgvkvdpscknaydllhnkhqhsyiifkidkndtaivvekvgeknapyaefveemkkl
vedgkecryaavdvevtvqrqgaegtstlnkvifvqycpdnapvrrrmlyassvralkas
lgleslfqvqasemsdldeksvksdlmsnqri

SCOPe Domain Coordinates for d2lxxa_:

Click to download the PDB-style file with coordinates for d2lxxa_.
(The format of our PDB-style files is described here.)

Timeline for d2lxxa_: