Lineage for d2lxta_ (2lxt A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482251Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily)
    3 helices; bundle, partly opened
  4. 1482252Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) (S)
    automatically mapped to Pfam PF02172
  5. 1482253Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein)
  6. 1482254Protein Kix domain of CBP (creb binding protein) [47042] (1 species)
  7. 1482255Species Mouse (Mus musculus) [TaxId:10090] [47043] (9 PDB entries)
  8. 1482258Domain d2lxta_: 2lxt A: [243030]
    automated match to d1sb0a_

Details for d2lxta_

PDB Entry: 2lxt (more details)

PDB Description: allosteric communication in the kix domain proceeds through dynamic re-packing of the hydrophobic core
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d2lxta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lxta_ a.12.1.1 (A:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
rdeyyhllaekiykiqkeleekrrsrl

SCOPe Domain Coordinates for d2lxta_:

Click to download the PDB-style file with coordinates for d2lxta_.
(The format of our PDB-style files is described here.)

Timeline for d2lxta_: