Class a: All alpha proteins [46456] (285 folds) |
Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily) 3 helices; bundle, partly opened |
Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) automatically mapped to Pfam PF02172 |
Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein) |
Protein Kix domain of CBP (creb binding protein) [47042] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47043] (9 PDB entries) |
Domain d2lxta_: 2lxt A: [243030] automated match to d1sb0a_ |
PDB Entry: 2lxt (more details)
SCOPe Domain Sequences for d2lxta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lxta_ a.12.1.1 (A:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]} gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans rdeyyhllaekiykiqkeleekrrsrl
Timeline for d2lxta_: