Lineage for d1ovwd_ (1ovw D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389601Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2389602Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (8 species)
  7. 2389606Species Fungus (Fusarium oxysporum) [TaxId:5507] [49976] (4 PDB entries)
  8. 2389618Domain d1ovwd_: 1ovw D: [24303]
    complexed with dp5, nag

Details for d1ovwd_

PDB Entry: 1ovw (more details), 2.7 Å

PDB Description: endoglucanase i complexed with non-hydrolysable substrate analogue
PDB Compounds: (D:) endoglucanase I

SCOPe Domain Sequences for d1ovwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovwd_ b.29.1.10 (D:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
vagpcdategdpknivkvqpnpevtfsnirigeigsts

SCOPe Domain Coordinates for d1ovwd_:

Click to download the PDB-style file with coordinates for d1ovwd_.
(The format of our PDB-style files is described here.)

Timeline for d1ovwd_: