![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily) 3 helices; bundle, partly opened |
![]() | Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) ![]() automatically mapped to Pfam PF02172 |
![]() | Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein) |
![]() | Protein Kix domain of CBP (creb binding protein) [47042] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47043] (13 PDB entries) |
![]() | Domain d2lxsa_: 2lxs A: [243029] automated match to d1sb0a_ |
PDB Entry: 2lxs (more details)
SCOPe Domain Sequences for d2lxsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lxsa_ a.12.1.1 (A:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]} gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans rdeyyhllaekiykiqkeleekrrsrl
Timeline for d2lxsa_: