Lineage for d2lxpa_ (2lxp A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164342Protein automated matches [190124] (12 species)
    not a true protein
  7. 2164354Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)
  8. 2164429Domain d2lxpa_: 2lxp A: [243027]
    Other proteins in same PDB: d2lxpc_
    automated match to d3fsha_
    complexed with zn

Details for d2lxpa_

PDB Entry: 2lxp (more details)

PDB Description: NMR structure of two domains in ubiquitin ligase gp78, RING and G2BR, bound to its conjugating enzyme Ube2g
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 G2

SCOPe Domain Sequences for d2lxpa_:

Sequence, based on SEQRES records: (download)

>d2lxpa_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsfp
ldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsvekill
svvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl

Sequence, based on observed residues (ATOM records): (download)

>d2lxpa_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsfp
ldyplsppkmrftcemfhpniypdgrvcisilhapgsaerwspvqsvekillsvvsmlae
pndesganvdaskmwrddreqfykiakqivqkslgl

SCOPe Domain Coordinates for d2lxpa_:

Click to download the PDB-style file with coordinates for d2lxpa_.
(The format of our PDB-style files is described here.)

Timeline for d2lxpa_: