Lineage for d2lxna_ (2lxn A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858751Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2858908Protein automated matches [190743] (4 species)
    not a true protein
  7. 2858929Species Methanocaldococcus jannaschii [TaxId:243232] [255467] (5 PDB entries)
  8. 2858930Domain d2lxna_: 2lxn A: [243026]
    automated match to d1wl8a1

Details for d2lxna_

PDB Entry: 2lxn (more details)

PDB Description: Solution NMR structure of glutamine amido transferase subunit of gaunosine monophosphate synthetase from Methanocaldococcus jannaschii
PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing] subunit A

SCOPe Domain Sequences for d2lxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lxna_ c.23.16.1 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mivildnggqyvhrihrslkyigvsskivpnttpleeiesnkevkgiilsggpdiekakn
cidialnaklpilgiclghqlialayggevgraeaeeyaltkvyvdkendlfknvprefn
awashkdevkkvpegfeilahsdicqveamkhktkpiygvqfhpevahteygneilknfc
kvcgykfe

SCOPe Domain Coordinates for d2lxna_:

Click to download the PDB-style file with coordinates for d2lxna_.
(The format of our PDB-style files is described here.)

Timeline for d2lxna_: