![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) ![]() the N-terminal domains of these repressors bind DNA |
![]() | Family b.34.1.2: FeoA-like [50041] (5 proteins) |
![]() | Protein automated matches [254603] (2 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255466] (1 PDB entry) |
![]() | Domain d2lx9a1: 2lx9 A:1-75 [243023] Other proteins in same PDB: d2lx9a2 automated match to d2gcxa1 |
PDB Entry: 2lx9 (more details)
SCOPe Domain Sequences for d2lx9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lx9a1 b.34.1.2 (A:1-75) automated matches {Escherichia coli K-12 [TaxId: 83333]} mqytpdtawkitgfsreispayrqkllslgmlpgssfnvvrvaplgdpihietrrvslvl rkkdlalleveavss
Timeline for d2lx9a1: