SCOPe 2.08: Domain d2lx9a1: 2lx9 A:1-75

Lineage for d2lx9a1 (2lx9 A:1-75)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: FeoA-like [50041] (5 proteins)

6. Protein automated matches [254603] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255466] (1 PDB entry)

8. Domain d2lx9a1: 2lx9 A:1-75 [243023]
   Other proteins in same PDB: d2lx9a2
   automated match to d2gcxa1

Details for d2lx9a1

PDB Entry: 2lx9

PDB Description: Solution Structure of Escherichia coli Ferrous Iron transport protein A (FeoA)

PDB Compounds: (A:) Ferrous iron transport protein A

SCOPe Domain Sequences for d2lx9a1:

Sequence; same for both SEQRES and ATOM records:

>d2lx9a1 b.34.1.2 (A:1-75) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mqytpdtawkitgfsreispayrqkllslgmlpgssfnvvrvaplgdpihietrrvslvl
rkkdlalleveavss

Timeline for d2lx9a1:

• d2lx9a1 first appeared in SCOPe 2.04, called d2lx9a_
  
• d2lx9a1 appears in SCOPe 2.07