![]() | Class g: Small proteins [56992] (92 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.0: automated matches [191345] (1 protein) not a true family |
![]() | Protein automated matches [190242] (3 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255464] (1 PDB entry) |
![]() | Domain d2lwra_: 2lwr A: [243019] automated match to d1wd2a_ complexed with zn |
PDB Entry: 2lwr (more details)
SCOPe Domain Sequences for d2lwra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lwra_ g.44.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gsaearwdeasnvtikvstkpcpkcrtpterdggcmhmvctragcgfewcwvcqtewtrd cmgahwfg
Timeline for d2lwra_: