Lineage for d2lwra_ (2lwr A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1966943Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1966944Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1967071Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 1967072Protein automated matches [190242] (3 species)
    not a true protein
  7. 1967073Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255464] (1 PDB entry)
  8. 1967074Domain d2lwra_: 2lwr A: [243019]
    automated match to d1wd2a_
    complexed with zn

Details for d2lwra_

PDB Entry: 2lwr (more details)

PDB Description: Solution Structure of RING2 Domain from Parkin
PDB Compounds: (A:) SD01679p

SCOPe Domain Sequences for d2lwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lwra_ g.44.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gsaearwdeasnvtikvstkpcpkcrtpterdggcmhmvctragcgfewcwvcqtewtrd
cmgahwfg

SCOPe Domain Coordinates for d2lwra_:

Click to download the PDB-style file with coordinates for d2lwra_.
(The format of our PDB-style files is described here.)

Timeline for d2lwra_: