SCOPe 2.04: Domain d2lwra_: 2lwr A:

Lineage for d2lwra_ (2lwr A:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.0: automated matches [191345] (1 protein)
   not a true family

6. Protein automated matches [190242] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255464] (1 PDB entry)

8. Domain d2lwra_: 2lwr A: [243019]
   automated match to d1wd2a_
   complexed with zn

Details for d2lwra_

PDB Entry: 2lwr

PDB Description: Solution Structure of RING2 Domain from Parkin

PDB Compounds: (A:) SD01679p

SCOPe Domain Sequences for d2lwra_:

Sequence; same for both SEQRES and ATOM records:

>d2lwra_ g.44.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gsaearwdeasnvtikvstkpcpkcrtpterdggcmhmvctragcgfewcwvcqtewtrd
cmgahwfg

Timeline for d2lwra_:

• d2lwra_ is new in SCOPe 2.04-stable
  
• d2lwra_ appears in SCOPe 2.05
  
• d2lwra_ appears in the current release, SCOPe 2.08, called d2lwra1