Lineage for d2lwra1 (2lwr A:417-482)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037682Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 3037683Protein automated matches [190242] (4 species)
    not a true protein
  7. 3037684Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255464] (1 PDB entry)
  8. 3037685Domain d2lwra1: 2lwr A:417-482 [243019]
    Other proteins in same PDB: d2lwra2
    automated match to d1wd2a_
    complexed with zn

Details for d2lwra1

PDB Entry: 2lwr (more details)

PDB Description: Solution Structure of RING2 Domain from Parkin
PDB Compounds: (A:) SD01679p

SCOPe Domain Sequences for d2lwra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lwra1 g.44.1.0 (A:417-482) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aearwdeasnvtikvstkpcpkcrtpterdggcmhmvctragcgfewcwvcqtewtrdcm
gahwfg

SCOPe Domain Coordinates for d2lwra1:

Click to download the PDB-style file with coordinates for d2lwra1.
(The format of our PDB-style files is described here.)

Timeline for d2lwra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lwra2