SCOPe 2.08: Domain d2lwra1: 2lwr A:417-482

Lineage for d2lwra1 (2lwr A:417-482)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.0: automated matches [191345] (1 protein)
   not a true family

6. Protein automated matches [190242] (4 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255464] (1 PDB entry)

8. Domain d2lwra1: 2lwr A:417-482 [243019]
   Other proteins in same PDB: d2lwra2
   automated match to d1wd2a_
   complexed with zn

Details for d2lwra1

PDB Entry: 2lwr

PDB Description: Solution Structure of RING2 Domain from Parkin

PDB Compounds: (A:) SD01679p

SCOPe Domain Sequences for d2lwra1:

Sequence; same for both SEQRES and ATOM records:

>d2lwra1 g.44.1.0 (A:417-482) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aearwdeasnvtikvstkpcpkcrtpterdggcmhmvctragcgfewcwvcqtewtrdcm
gahwfg

Timeline for d2lwra1:

• d2lwra1 first appeared in SCOPe 2.04, called d2lwra_
  
• d2lwra1 appears in SCOPe 2.07