| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins) automatically mapped to Pfam PF01404 |
| Protein automated matches [190969] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries) |
| Domain d2lw8a1: 2lw8 A:3-183 [243016] Other proteins in same PDB: d2lw8a2 automated match to d2wo1a_ |
PDB Entry: 2lw8 (more details)
SCOPe Domain Sequences for d2lw8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lw8a1 b.18.1.4 (A:3-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdw
itregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidti
aadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykkapltv
r
Timeline for d2lw8a1: