SCOPe 2.08: Domain d1ovwb_: 1ovw B:

Lineage for d1ovwb_ (1ovw B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold
   automatically mapped to Pfam PF00840

6. Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (8 species)

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [49976] (4 PDB entries)

8. Domain d1ovwb_: 1ovw B: [24301]
   complexed with nag

Details for d1ovwb_

PDB Entry: 1ovw, 2.7 Å

PDB Description: endoglucanase i complexed with non-hydrolysable substrate analogue

PDB Compounds: (B:) endoglucanase I

SCOPe Domain Sequences for d1ovwb_:

Sequence; same for both SEQRES and ATOM records:

>d1ovwb_ b.29.1.10 (B:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
vagpcdategdpknivkvqpnpevtfsnirigeigsts

Timeline for d1ovwb_:

• d1ovwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ovwb_ appears in SCOPe 2.07