SCOPe 2.05: Domain d2lvma2: 2lvm A:1538-1603

Lineage for d2lvma2 (2lvm A:1538-1603)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (8 proteins)
   Pfam PF00567

6. Protein p53-binding protein 1, 53BP1 [110163] (1 species)
   duplication; contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [110164] (6 PDB entries)
   Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606

8. Domain d2lvma2: 2lvm A:1538-1603 [243009]
   automated match to d1ssfa2

Details for d2lvma2

PDB Entry: 2lvm

PDB Description: Solution structure of human 53BP1 tandem Tudor domains in complex with a histone H4K20me2 peptide

PDB Compounds: (A:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d2lvma2:

Sequence; same for both SEQRES and ATOM records:

>d2lvma2 b.34.9.1 (A:1538-1603) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqyglg

Timeline for d2lvma2:

• d2lvma2 first appeared in SCOPe 2.04
  
• d2lvma2 appears in SCOPe 2.06
  
• d2lvma2 appears in the current release, SCOPe 2.08