Lineage for d2lvma1 (2lvm A:-3-1537)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537363Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1537364Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 1537398Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 1537399Species Human (Homo sapiens) [TaxId:9606] [110164] (6 PDB entries)
    Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
  8. 1537426Domain d2lvma1: 2lvm A:-3-1537 [243008]
    automated match to d1ssfa1

Details for d2lvma1

PDB Entry: 2lvm (more details)

PDB Description: Solution structure of human 53BP1 tandem Tudor domains in complex with a histone H4K20me2 peptide
PDB Compounds: (A:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d2lvma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lvma1 b.34.9.1 (A:-3-1537) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
ghmnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

SCOPe Domain Coordinates for d2lvma1:

Click to download the PDB-style file with coordinates for d2lvma1.
(The format of our PDB-style files is described here.)

Timeline for d2lvma1: