Class a: All alpha proteins [46456] (285 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.10: Polcalcin [89048] (3 proteins) calcium-binding pollen allergen; two EF-hands per subunit |
Protein Polcalcin phl p 7 [89049] (1 species) |
Species Timothy grass (Phleum pratense) [TaxId:15957] [89050] (4 PDB entries) |
Domain d2lvia_: 2lvi A: [243005] automated match to d1k9ua_ |
PDB Entry: 2lvi (more details)
SCOPe Domain Sequences for d2lvia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lvia_ a.39.1.10 (A:) Polcalcin phl p 7 {Timothy grass (Phleum pratense) [TaxId: 15957]} addmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnefi sfcnanpglmkdvakvf
Timeline for d2lvia_: