Lineage for d2lvia_ (2lvi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711564Family a.39.1.10: Polcalcin [89048] (3 proteins)
    calcium-binding pollen allergen; two EF-hands per subunit
  6. 2711577Protein Polcalcin phl p 7 [89049] (1 species)
  7. 2711578Species Timothy grass (Phleum pratense) [TaxId:15957] [89050] (4 PDB entries)
  8. 2711583Domain d2lvia_: 2lvi A: [243005]
    automated match to d1k9ua_

Details for d2lvia_

PDB Entry: 2lvi (more details)

PDB Description: Solution structure of apo-Phl p 7
PDB Compounds: (A:) Polcalcin Phl p 7

SCOPe Domain Sequences for d2lvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lvia_ a.39.1.10 (A:) Polcalcin phl p 7 {Timothy grass (Phleum pratense) [TaxId: 15957]}
addmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnefi
sfcnanpglmkdvakvf

SCOPe Domain Coordinates for d2lvia_:

Click to download the PDB-style file with coordinates for d2lvia_.
(The format of our PDB-style files is described here.)

Timeline for d2lvia_: