![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
![]() | Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins) Pfam PF00035 |
![]() | Protein automated matches [191157] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [255462] (2 PDB entries) |
![]() | Domain d2luqa1: 2luq A:366-453 [243001] Other proteins in same PDB: d2luqa2 automated match to d1t4lb_ |
PDB Entry: 2luq (more details)
SCOPe Domain Sequences for d2luqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2luqa1 d.50.1.1 (A:366-453) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikiagi raaenalrdkkmldfyakqraaiprses
Timeline for d2luqa1: