Lineage for d2luqa1 (2luq A:366-453)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553728Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2553729Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2553730Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2553802Protein automated matches [191157] (3 species)
    not a true protein
  7. 2553805Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [255462] (2 PDB entries)
  8. 2553806Domain d2luqa1: 2luq A:366-453 [243001]
    Other proteins in same PDB: d2luqa2
    automated match to d1t4lb_

Details for d2luqa1

PDB Entry: 2luq (more details)

PDB Description: Solution structure of double-stranded RNA binding domain of S.cerevisiae RNase III (rnt1p)
PDB Compounds: (A:) Ribonuclease 3

SCOPe Domain Sequences for d2luqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2luqa1 d.50.1.1 (A:366-453) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikiagi
raaenalrdkkmldfyakqraaiprses

SCOPe Domain Coordinates for d2luqa1:

Click to download the PDB-style file with coordinates for d2luqa1.
(The format of our PDB-style files is described here.)

Timeline for d2luqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2luqa2