SCOPe 2.04: Domain d2luqa_: 2luq A:

Lineage for d2luqa_ (2luq A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
   Pfam PF00035

6. Protein automated matches [191157] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [255462] (2 PDB entries)

8. Domain d2luqa_: 2luq A: [243001]
   automated match to d1t4lb_

Details for d2luqa_

PDB Entry: 2luq

PDB Description: Solution structure of double-stranded RNA binding domain of S.cerevisiae RNase III (rnt1p)

PDB Compounds: (A:) Ribonuclease 3

SCOPe Domain Sequences for d2luqa_:

Sequence; same for both SEQRES and ATOM records:

>d2luqa_ d.50.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikia
giraaenalrdkkmldfyakqraaiprses

Timeline for d2luqa_:

• d2luqa_ is new in SCOPe 2.04-stable
  
• d2luqa_ appears in SCOPe 2.05
  
• d2luqa_ appears in the current release, SCOPe 2.08, called d2luqa1