Lineage for d2lupb1 (2lup B:366-453)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553728Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2553729Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2553730Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2553802Protein automated matches [191157] (3 species)
    not a true protein
  7. 2553805Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [255462] (2 PDB entries)
  8. 2553807Domain d2lupb1: 2lup B:366-453 [243000]
    Other proteins in same PDB: d2lupb2
    automated match to d1t4lb_
    protein/RNA complex

Details for d2lupb1

PDB Entry: 2lup (more details)

PDB Description: RDC refined solution structure of double-stranded RNA binding domain of S. cerevisiae RNase III (rnt1p) in complex with the terminal RNA hairpin of snr47 precursor
PDB Compounds: (B:) Ribonuclease 3

SCOPe Domain Sequences for d2lupb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lupb1 d.50.1.1 (B:366-453) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikiagi
raaenalrdkkmldfyakqraaiprses

SCOPe Domain Coordinates for d2lupb1:

Click to download the PDB-style file with coordinates for d2lupb1.
(The format of our PDB-style files is described here.)

Timeline for d2lupb1: