SCOPe 2.04: Domain d2lupb_: 2lup B:

Lineage for d2lupb_ (2lup B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
   Pfam PF00035

6. Protein automated matches [191157] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [255462] (2 PDB entries)

8. Domain d2lupb_: 2lup B: [243000]
   automated match to d1t4lb_
   protein/RNA complex

Details for d2lupb_

PDB Entry: 2lup

PDB Description: RDC refined solution structure of double-stranded RNA binding domain of S. cerevisiae RNase III (rnt1p) in complex with the terminal RNA hairpin of snr47 precursor

PDB Compounds: (B:) Ribonuclease 3

SCOPe Domain Sequences for d2lupb_:

Sequence; same for both SEQRES and ATOM records:

>d2lupb_ d.50.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikia
giraaenalrdkkmldfyakqraaiprses

Timeline for d2lupb_:

• d2lupb_ is new in SCOPe 2.04-stable
  
• d2lupb_ appears in SCOPe 2.05
  
• d2lupb_ appears in the current release, SCOPe 2.08, called d2lupb1