Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species) |
Species Streptococcus sp., group G [TaxId:1306] [54361] (35 PDB entries) |
Domain d2luma1: 2lum A:3-56 [242998] Other proteins in same PDB: d2luma2 automated match to d1p7fa_ |
PDB Entry: 2lum (more details)
SCOPe Domain Sequences for d2luma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2luma1 d.15.7.1 (A:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]} yklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte
Timeline for d2luma1: