Lineage for d2luma1 (2lum A:3-56)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179961Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2179962Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2179987Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2180014Species Streptococcus sp., group G [TaxId:1306] [54361] (35 PDB entries)
  8. 2180053Domain d2luma1: 2lum A:3-56 [242998]
    Other proteins in same PDB: d2luma2
    automated match to d1p7fa_

Details for d2luma1

PDB Entry: 2lum (more details)

PDB Description: Three-State Ensemble obtained from eNOEs of the Third Immunoglobulin Binding Domain of Protein G (GB3)
PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d2luma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2luma1 d.15.7.1 (A:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
yklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte

SCOPe Domain Coordinates for d2luma1:

Click to download the PDB-style file with coordinates for d2luma1.
(The format of our PDB-style files is described here.)

Timeline for d2luma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2luma2