Lineage for d2lucb_ (2luc B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489488Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1489693Protein automated matches [190132] (3 species)
    not a true protein
  7. 1489696Species Human (Homo sapiens) [TaxId:9606] [187203] (33 PDB entries)
  8. 1489771Domain d2lucb_: 2luc B: [242996]
    automated match to d1nsha_

Details for d2lucb_

PDB Entry: 2luc (more details)

PDB Description: Solution Structure of human S100 calcium-binding protein A11
PDB Compounds: (B:) Protein S100-A11

SCOPe Domain Sequences for d2lucb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lucb_ a.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
makisspteterciesliavfqkyagkdgynytlskteflsfmntelaaftknqkdpgvl
drmmkkldtnsdgqldfseflnligglamachdsflkavpsqkrt

SCOPe Domain Coordinates for d2lucb_:

Click to download the PDB-style file with coordinates for d2lucb_.
(The format of our PDB-style files is described here.)

Timeline for d2lucb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2luca_