SCOPe 2.04: Domain d2lu4a_: 2lu4 A:

Lineage for d2lu4a_ (2lu4 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
   lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)

6. Protein 5'-AMP-activated protein kinase subunit beta-2 [158887] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255461] (2 PDB entries)

8. Domain d2lu4a_: 2lu4 A: [242994]
   automated match to d2f15a1

Details for d2lu4a_

PDB Entry: 2lu4

PDB Description: Solution NMR structure of the beta2 carbohydrate module of AMP-activated protein kinase bound to glucosyl-cyclodextrin

PDB Compounds: (A:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d2lu4a_:

Sequence; same for both SEQRES and ATOM records:

>d2lu4a_ b.1.18.21 (A:) 5'-AMP-activated protein kinase subunit beta-2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gamgirnsdsvkptqqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlp
egehqykffvdgqwvhdpsepvvtsqlgtinnlihvkksdfevfd

Timeline for d2lu4a_:

• d2lu4a_ is new in SCOPe 2.04-stable
  
• d2lu4a_ appears in SCOPe 2.05
  
• d2lu4a_ appears in the current release, SCOPe 2.08, called d2lu4a1