Lineage for d2lu3a1 (2lu3 A:9-105)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375949Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
    lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)
  6. 2375954Protein 5'-AMP-activated protein kinase subunit beta-2 [158887] (2 species)
  7. 2375957Species Norway rat (Rattus norvegicus) [TaxId:10116] [255461] (4 PDB entries)
  8. 2375979Domain d2lu3a1: 2lu3 A:9-105 [242993]
    Other proteins in same PDB: d2lu3a2
    automated match to d2f15a1

Details for d2lu3a1

PDB Entry: 2lu3 (more details)

PDB Description: Solution NMR structure of the apo-form of the beta2 carbohydrate module of AMP-activated protein kinase
PDB Compounds: (A:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d2lu3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lu3a1 b.1.18.21 (A:9-105) 5'-AMP-activated protein kinase subunit beta-2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dsvkptqqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykf
fvdgqwvhdpsepvvtsqlgtinnlihvkksdfevfd

SCOPe Domain Coordinates for d2lu3a1:

Click to download the PDB-style file with coordinates for d2lu3a1.
(The format of our PDB-style files is described here.)

Timeline for d2lu3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lu3a2