SCOPe 2.08: Domain d2lu3a1: 2lu3 A:9-105

Lineage for d2lu3a1 (2lu3 A:9-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
   lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)

6. Protein 5'-AMP-activated protein kinase subunit beta-2 [158887] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255461] (4 PDB entries)

8. Domain d2lu3a1: 2lu3 A:9-105 [242993]
   Other proteins in same PDB: d2lu3a2
   automated match to d2f15a1

Details for d2lu3a1

PDB Entry: 2lu3

PDB Description: Solution NMR structure of the apo-form of the beta2 carbohydrate module of AMP-activated protein kinase

PDB Compounds: (A:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d2lu3a1:

Sequence; same for both SEQRES and ATOM records:

>d2lu3a1 b.1.18.21 (A:9-105) 5'-AMP-activated protein kinase subunit beta-2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dsvkptqqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykf
fvdgqwvhdpsepvvtsqlgtinnlihvkksdfevfd

Timeline for d2lu3a1:

• d2lu3a1 first appeared in SCOPe 2.04, called d2lu3a_
  
• d2lu3a1 appears in SCOPe 2.07