| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins) lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G) |
| Protein 5'-AMP-activated protein kinase subunit beta-2 [158887] (2 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [255461] (4 PDB entries) |
| Domain d2lu3a1: 2lu3 A:9-105 [242993] Other proteins in same PDB: d2lu3a2 automated match to d2f15a1 |
PDB Entry: 2lu3 (more details)
SCOPe Domain Sequences for d2lu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lu3a1 b.1.18.21 (A:9-105) 5'-AMP-activated protein kinase subunit beta-2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dsvkptqqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykf
fvdgqwvhdpsepvvtsqlgtinnlihvkksdfevfd
Timeline for d2lu3a1: