![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.27: CalX-like [141072] (2 families) ![]() |
![]() | Family b.1.27.1: CalX-beta domain [141073] (2 proteins) Pfam PF03160 |
![]() | Protein automated matches [227001] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255460] (1 PDB entry) |
![]() | Domain d2lt9a_: 2lt9 A: [242990] automated match to d2fwua1 |
PDB Entry: 2lt9 (more details)
SCOPe Domain Sequences for d2lt9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lt9a_ b.1.27.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} hagiftfecdtihvsesigvmevkvlrtsgargtvivpfrtvegtakgggedfedaygel efkndetvktirvkivdeeeyerqenffialgepkwmergisevtdrkltveeeeakria emgkpvlgehpkleviieesyefkstvd
Timeline for d2lt9a_: