SCOPe 2.04: Domain d2lt9a_: 2lt9 A:

Lineage for d2lt9a_ (2lt9 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.27: CalX-like [141072] (2 families)

5. Family b.1.27.1: CalX-beta domain [141073] (2 proteins)
   Pfam PF03160

6. Protein automated matches [227001] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255460] (1 PDB entry)

8. Domain d2lt9a_: 2lt9 A: [242990]
   automated match to d2fwua1

Details for d2lt9a_

PDB Entry: 2lt9

PDB Description: The solution structure of Ca2+ binding domain 2B of the third isoform of the Na+/Ca2+ exchanger

PDB Compounds: (A:) Protein Slc8a3

SCOPe Domain Sequences for d2lt9a_:

Sequence; same for both SEQRES and ATOM records:

>d2lt9a_ b.1.27.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hagiftfecdtihvsesigvmevkvlrtsgargtvivpfrtvegtakgggedfedaygel
efkndetvktirvkivdeeeyerqenffialgepkwmergisevtdrkltveeeeakria
emgkpvlgehpkleviieesyefkstvd

Timeline for d2lt9a_:

• d2lt9a_ is new in SCOPe 2.04-stable
  
• d2lt9a_ appears in SCOPe 2.05
  
• d2lt9a_ appears in the current release, SCOPe 2.08