Lineage for d2lt9a_ (2lt9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766760Superfamily b.1.27: CalX-like [141072] (2 families) (S)
  5. 2766761Family b.1.27.1: CalX-beta domain [141073] (2 proteins)
    Pfam PF03160
  6. 2766767Protein automated matches [227001] (3 species)
    not a true protein
  7. 2766774Species Mouse (Mus musculus) [TaxId:10090] [255460] (1 PDB entry)
  8. 2766775Domain d2lt9a_: 2lt9 A: [242990]
    automated match to d2fwua1

Details for d2lt9a_

PDB Entry: 2lt9 (more details)

PDB Description: The solution structure of Ca2+ binding domain 2B of the third isoform of the Na+/Ca2+ exchanger
PDB Compounds: (A:) Protein Slc8a3

SCOPe Domain Sequences for d2lt9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lt9a_ b.1.27.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hagiftfecdtihvsesigvmevkvlrtsgargtvivpfrtvegtakgggedfedaygel
efkndetvktirvkivdeeeyerqenffialgepkwmergisevtdrkltveeeeakria
emgkpvlgehpkleviieesyefkstvd

SCOPe Domain Coordinates for d2lt9a_:

Click to download the PDB-style file with coordinates for d2lt9a_.
(The format of our PDB-style files is described here.)

Timeline for d2lt9a_: