Lineage for d2lssa_ (2lss A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383832Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2383833Protein automated matches [190576] (33 species)
    not a true protein
  7. 2383969Species Rickettsia rickettsii [TaxId:392021] [255459] (1 PDB entry)
  8. 2383970Domain d2lssa_: 2lss A: [242989]
    automated match to d3cama_

Details for d2lssa_

PDB Entry: 2lss (more details)

PDB Description: Solution structure of the R. rickettsii cold shock-like protein
PDB Compounds: (A:) Cold shock-like protein

SCOPe Domain Sequences for d2lssa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lssa_ b.40.4.0 (A:) automated matches {Rickettsia rickettsii [TaxId: 392021]}
matnivgkvkwynstknfgfieqdnggkdvfvhksavdaaglhsleegqdvifdleekqg
kayavnlrik

SCOPe Domain Coordinates for d2lssa_:

Click to download the PDB-style file with coordinates for d2lssa_.
(The format of our PDB-style files is described here.)

Timeline for d2lssa_: