SCOPe 2.05: Domain d2lrwa_: 2lrw A:

Lineage for d2lrwa_ (2lrw A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (11 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [229344] (2 PDB entries)

8. Domain d2lrwa_: 2lrw A: [242984]
   automated match to d3rula_

Details for d2lrwa_

PDB Entry: 2lrw

PDB Description: Solution structure of a ubiquitin-like protein from Trypanosoma brucei

PDB Compounds: (A:) Ubiquitin, putative

SCOPe Domain Sequences for d2lrwa_:

Sequence; same for both SEQRES and ATOM records:

>d2lrwa_ d.15.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
mllkvktvsnkviqitsltddntiaelkgkleesegipgnmirlvyqgkqledekrlkdy
qmsagatfhmvvalragc

Timeline for d2lrwa_:

• d2lrwa_ first appeared in SCOPe 2.04
  
• d2lrwa_ appears in SCOPe 2.06
  
• d2lrwa_ appears in the current release, SCOPe 2.08