Lineage for d2lrra_ (2lrr A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656170Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1656530Superfamily d.68.7: R3H domain [82708] (1 family) (S)
    possibly lacks the N-terminal strand of the common fold
  5. 1656531Family d.68.7.1: R3H domain [82709] (4 proteins)
    Pfam PF01424; predicted nucleic acid-binding domain
  6. 1656541Protein automated matches [254602] (1 species)
    not a true protein
  7. 1656542Species Human (Homo sapiens) [TaxId:9606] [255456] (1 PDB entry)
  8. 1656543Domain d2lrra_: 2lrr A: [242983]
    automated match to d1msza_
    protein/DNA complex; complexed with dgp

Details for d2lrra_

PDB Entry: 2lrr (more details)

PDB Description: Solution structure of the R3H domain from human Smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate
PDB Compounds: (A:) DNA-binding protein SMUBP-2

SCOPe Domain Sequences for d2lrra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lrra_ d.68.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pegvesqdgvdhframivefmaskkmqlefppslnshdrlrvhqiaeehglrhdssgegk
rrfitvskra

SCOPe Domain Coordinates for d2lrra_:

Click to download the PDB-style file with coordinates for d2lrra_.
(The format of our PDB-style files is described here.)

Timeline for d2lrra_: