Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.7: R3H domain [82708] (1 family) possibly lacks the N-terminal strand of the common fold |
Family d.68.7.1: R3H domain [82709] (4 proteins) Pfam PF01424; predicted nucleic acid-binding domain |
Protein automated matches [254602] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255456] (1 PDB entry) |
Domain d2lrra_: 2lrr A: [242983] automated match to d1msza_ protein/DNA complex; complexed with dgp |
PDB Entry: 2lrr (more details)
SCOPe Domain Sequences for d2lrra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lrra_ d.68.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pegvesqdgvdhframivefmaskkmqlefppslnshdrlrvhqiaeehglrhdssgegk rrfitvskra
Timeline for d2lrra_: