Lineage for d2lrpa1 (2lrp A:4-170)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774904Family b.18.1.30: CBM11 [141116] (2 proteins)
    Pfam PF03425; Carbohydrate binding domain (family 11)
  6. 2774910Protein automated matches [254601] (1 species)
    not a true protein
  7. 2774911Species Clostridium thermocellum [TaxId:203119] [255454] (2 PDB entries)
  8. 2774913Domain d2lrpa1: 2lrp A:4-170 [242981]
    Other proteins in same PDB: d2lrpa2, d2lrpa3
    automated match to d1v0aa1
    complexed with ca

Details for d2lrpa1

PDB Entry: 2lrp (more details)

PDB Description: Solution structure, dynamics and binding studies of CtCBM11
PDB Compounds: (A:) endoglucanase h

SCOPe Domain Sequences for d2lrpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lrpa1 b.18.1.30 (A:4-170) automated matches {Clostridium thermocellum [TaxId: 203119]}
avgekmlddfegvlnwgsysgegakvstkivsgktgngmevsytgttdgywgtvyslpdg
dwskwlkisfdiksvdgsaneirfmiaeksingvgdgehwvysitpdsswktieipfssf
rrrldyqppgqdmsgtldldnidsihfmyannksgkfvvdnikliga

SCOPe Domain Coordinates for d2lrpa1:

Click to download the PDB-style file with coordinates for d2lrpa1.
(The format of our PDB-style files is described here.)

Timeline for d2lrpa1: