![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.30: CBM11 [141116] (2 proteins) Pfam PF03425; Carbohydrate binding domain (family 11) |
![]() | Protein automated matches [254601] (1 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:203119] [255454] (2 PDB entries) |
![]() | Domain d2lrpa1: 2lrp A:4-170 [242981] Other proteins in same PDB: d2lrpa2, d2lrpa3 automated match to d1v0aa1 complexed with ca |
PDB Entry: 2lrp (more details)
SCOPe Domain Sequences for d2lrpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lrpa1 b.18.1.30 (A:4-170) automated matches {Clostridium thermocellum [TaxId: 203119]} avgekmlddfegvlnwgsysgegakvstkivsgktgngmevsytgttdgywgtvyslpdg dwskwlkisfdiksvdgsaneirfmiaeksingvgdgehwvysitpdsswktieipfssf rrrldyqppgqdmsgtldldnidsihfmyannksgkfvvdnikliga
Timeline for d2lrpa1: