Lineage for d2ovwc_ (2ovw C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051184Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2051185Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (7 species)
  7. 2051189Species Fungus (Fusarium oxysporum) [TaxId:5507] [49976] (4 PDB entries)
  8. 2051196Domain d2ovwc_: 2ovw C: [24298]
    complexed with cbi, nag

Details for d2ovwc_

PDB Entry: 2ovw (more details), 2.3 Å

PDB Description: endoglucanase i complexed with cellobiose
PDB Compounds: (C:) endoglucanase I

SCOPe Domain Sequences for d2ovwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovwc_ b.29.1.10 (C:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
vagpcdategdpknivkvqpnpevtfsnirigeigsts

SCOPe Domain Coordinates for d2ovwc_:

Click to download the PDB-style file with coordinates for d2ovwc_.
(The format of our PDB-style files is described here.)

Timeline for d2ovwc_: