Lineage for d2lrld_ (2lrl D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1662367Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 1662368Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 1662369Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 1662386Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 1662413Species Escherichia coli [TaxId:562] [55599] (17 PDB entries)
  8. 1662421Domain d2lrld_: 2lrl D: [242978]
    Other proteins in same PDB: d2lrla_, d2lrlb_, d2lrlc_
    automated match to d1poha_
    complexed with po3

Details for d2lrld_

PDB Entry: 2lrl (more details)

PDB Description: Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System
PDB Compounds: (D:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d2lrld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lrld_ d.94.1.1 (D:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOPe Domain Coordinates for d2lrld_:

Click to download the PDB-style file with coordinates for d2lrld_.
(The format of our PDB-style files is described here.)

Timeline for d2lrld_: