Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) |
Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species) |
Species Escherichia coli [TaxId:562] [55599] (17 PDB entries) |
Domain d2lrld_: 2lrl D: [242978] Other proteins in same PDB: d2lrla_, d2lrlb_, d2lrlc_ automated match to d1poha_ complexed with po3 |
PDB Entry: 2lrl (more details)
SCOPe Domain Sequences for d2lrld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lrld_ d.94.1.1 (D:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]} mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv vtisaegedeqkavehlvklmaele
Timeline for d2lrld_: