Lineage for d2lrkb_ (2lrk B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308817Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2308865Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) (S)
  5. 2308875Family a.7.2.0: automated matches [191602] (1 protein)
    not a true family
  6. 2308876Protein automated matches [191097] (4 species)
    not a true protein
  7. 2308887Species Escherichia coli K-12 [TaxId:83333] [255453] (2 PDB entries)
  8. 2308892Domain d2lrkb_: 2lrk B: [242972]
    Other proteins in same PDB: d2lrkd_
    automated match to d3l8ra_

Details for d2lrkb_

PDB Entry: 2lrk (more details)

PDB Description: Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose
PDB Compounds: (B:) n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component

SCOPe Domain Sequences for d2lrkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lrkb_ a.7.2.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlveaqlhlmtsmlarelitelielheklka

SCOPe Domain Coordinates for d2lrkb_:

Click to download the PDB-style file with coordinates for d2lrkb_.
(The format of our PDB-style files is described here.)

Timeline for d2lrkb_: