SCOPe 2.07: Domain d2lrka_: 2lrk A:

Lineage for d2lrka_ (2lrk A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families)

5. Family a.7.2.0: automated matches [191602] (1 protein)
   not a true family

6. Protein automated matches [191097] (4 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255453] (2 PDB entries)

8. Domain d2lrka_: 2lrk A: [242971]
   Other proteins in same PDB: d2lrkd_
   automated match to d3l8ra_

Details for d2lrka_

PDB Entry: 2lrk

PDB Description: Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose

PDB Compounds: (A:) n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component

SCOPe Domain Sequences for d2lrka_:

Sequence; same for both SEQRES and ATOM records:

>d2lrka_ a.7.2.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlveaqlhlmtsmlarelitelielheklka

Timeline for d2lrka_:

• d2lrka_ first appeared in SCOPe 2.04
  
• d2lrka_ appears in SCOPe 2.06
  
• d2lrka_ appears in the current release, SCOPe 2.08