Lineage for d2lqha_ (2lqh A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986861Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily)
    3 helices; bundle, partly opened
  4. 1986862Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) (S)
    automatically mapped to Pfam PF02172
  5. 1986863Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein)
  6. 1986864Protein Kix domain of CBP (creb binding protein) [47042] (1 species)
  7. 1986865Species Mouse (Mus musculus) [TaxId:10090] [47043] (10 PDB entries)
  8. 1986873Domain d2lqha_: 2lqh A: [242967]
    automated match to d1sb0a_

Details for d2lqha_

PDB Entry: 2lqh (more details)

PDB Description: NMR structure of FOXO3a transactivation domains (CR2C-CR3) in complex with CBP KIX domain (2b3l conformation)
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d2lqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lqha_ a.12.1.1 (A:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
rdeyyhllaekiykiqkeleekrrsrl

SCOPe Domain Coordinates for d2lqha_:

Click to download the PDB-style file with coordinates for d2lqha_.
(The format of our PDB-style files is described here.)

Timeline for d2lqha_: