Lineage for d2lqda_ (2lqd A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005161Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2005162Species Pseudomonas putida [TaxId:303] [48267] (115 PDB entries)
    Uniprot P00183
  8. 2005310Domain d2lqda_: 2lqd A: [242966]
    automated match to d3fwgb_
    complexed with hem, k

Details for d2lqda_

PDB Entry: 2lqd (more details)

PDB Description: reduced and co-bound cytochrome p450cam (cyp101a1)
PDB Compounds: (A:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d2lqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lqda_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d2lqda_:

Click to download the PDB-style file with coordinates for d2lqda_.
(The format of our PDB-style files is described here.)

Timeline for d2lqda_: