SCOPe 2.06: Domain d2lqba1: 2lqb A:5-76

Lineage for d2lqba1 (2lqb A:5-76)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.0: automated matches [191590] (1 protein)
   not a true family

6. Protein automated matches [191063] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254969] (11 PDB entries)

8. Domain d2lqba1: 2lqb A:5-76 [242965]
   Other proteins in same PDB: d2lqba2
   automated match to d1q8la_

Details for d2lqba1

PDB Entry: 2lqb

PDB Description: Metal binding repeat 2 of the Wilson disease protein (ATP7B)

PDB Compounds: (A:) Copper-transporting ATPase 2

SCOPe Domain Sequences for d2lqba1:

Sequence; same for both SEQRES and ATOM records:

>d2lqba1 d.58.17.0 (A:5-76) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeavvklrvegmtcqscvssiegkvrklqgvvrvkvslsnqeavityqpyliqpedlrdh
vndmgfeaaiks

Timeline for d2lqba1:

• d2lqba1 first appeared in SCOPe 2.04, called d2lqba_
  
• d2lqba1 was called d2lqba_ in SCOPe 2.05
  
• d2lqba1 appears in SCOPe 2.07
  
• d2lqba1 appears in the current release, SCOPe 2.08