SCOPe 2.06: Domain d2lpxa_: 2lpx A:

Lineage for d2lpxa_ (2lpx A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (22 species)
   not a true protein

7. Species Fragaria x [TaxId:3747] [228292] (4 PDB entries)

8. Domain d2lpxa_: 2lpx A: [242962]
   automated match to d4c9ca_

Details for d2lpxa_

PDB Entry: 2lpx

PDB Description: Solution Structure of Strawberry Allergen Fra a 1e

PDB Compounds: (A:) Major strawberry allergen Fra a 1-E

SCOPe Domain Sequences for d2lpxa_:

Sequence; same for both SEQRES and ATOM records:

>d2lpxa_ d.129.3.0 (A:) automated matches {Fragaria x [TaxId: 3747]}
gvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkitfge
gshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttsky
htkgdveikeehvkagkekaahlfkliegylkdhpseyn

Timeline for d2lpxa_:

• d2lpxa_ first appeared in SCOPe 2.04
  
• d2lpxa_ appears in SCOPe 2.05
  
• d2lpxa_ appears in SCOPe 2.07
  
• d2lpxa_ appears in the current release, SCOPe 2.08