Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (22 species) not a true protein |
Species Fragaria x [TaxId:3747] [228292] (4 PDB entries) |
Domain d2lpxa_: 2lpx A: [242962] automated match to d4c9ca_ |
PDB Entry: 2lpx (more details)
SCOPe Domain Sequences for d2lpxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lpxa_ d.129.3.0 (A:) automated matches {Fragaria x [TaxId: 3747]} gvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkitfge gshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttsky htkgdveikeehvkagkekaahlfkliegylkdhpseyn
Timeline for d2lpxa_: