SCOPe 2.06: Domain d2lp2a_: 2lp2 A:

Lineage for d2lp2a_ (2lp2 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (42 PDB entries)

8. Domain d2lp2a_: 2lp2 A: [242954]
   automated match to d1k2ha_
   complexed with ca, hcs

Details for d2lp2a_

PDB Entry: 2lp2

PDB Description: Solution structure and dynamics of human S100A1 protein modified at cysteine 85 with homocysteine disulfide bond formation in calcium saturated form

PDB Compounds: (A:) Protein S100-A1

SCOPe Domain Sequences for d2lp2a_:

Sequence; same for both SEQRES and ATOM records:

>d2lp2a_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
ldengdgevdfqeyvvlvaaltvacnnffwens

Timeline for d2lp2a_:

• d2lp2a_ first appeared in SCOPe 2.04
  
• d2lp2a_ appears in SCOPe 2.05
  
• d2lp2a_ appears in SCOPe 2.07
  
• d2lp2a_ appears in the current release, SCOPe 2.08