Lineage for d2loxa1 (2lox A:2-115)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2413156Family b.55.1.9: TFIIH domain [110272] (2 proteins)
  6. 2413157Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (2 species)
  7. 2413158Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141435] (9 PDB entries)
    Uniprot P32776 2-115
  8. 2413166Domain d2loxa1: 2lox A:2-115 [242951]
    Other proteins in same PDB: d2loxa2
    automated match to d1y5oa1

Details for d2loxa1

PDB Entry: 2lox (more details)

PDB Description: NMR structure of the complex between the PH domain of the Tfb1 subunit from TFIIH and Rad2
PDB Compounds: (A:) RNA polymerase II transcription factor B subunit 1

SCOPe Domain Sequences for d2loxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2loxa1 b.55.1.9 (A:2-115) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmmlr
ligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

SCOPe Domain Coordinates for d2loxa1:

Click to download the PDB-style file with coordinates for d2loxa1.
(The format of our PDB-style files is described here.)

Timeline for d2loxa1: