![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
![]() | Protein automated matches [191038] (14 species) not a true protein |
![]() | Species Rickettsia prowazekii [TaxId:272947] [255452] (1 PDB entry) |
![]() | Domain d2lola_: 2lol A: [242950] automated match to d3gzma_ |
PDB Entry: 2lol (more details)
SCOPe Domain Sequences for d2lola_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lola_ a.28.1.0 (A:) automated matches {Rickettsia prowazekii [TaxId: 272947]} msttdkieqkviemvaeklnkdkaiittdsrfiedlkadsldtvelmmaieveygidipd deatkiktvsdvikyikerqs
Timeline for d2lola_: