Lineage for d2lnxa_ (2lnx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965705Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2965706Protein automated matches [190561] (4 species)
    not a true protein
  7. 2965707Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2965889Domain d2lnxa_: 2lnx A: [242948]
    automated match to d1ab2a_

Details for d2lnxa_

PDB Entry: 2lnx (more details)

PDB Description: Solution structure of Vav2 SH2 domain
PDB Compounds: (A:) Guanine nucleotide exchange factor VAV2

SCOPe Domain Sequences for d2lnxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lnxa_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srppsreidytaypwfagnmerqqtdnllkshasgtylirerpaeaerfaisikfndevk
hikvvekdnwihiteakkfdsllelveyyqchslkesfkqldttlkypyksre

SCOPe Domain Coordinates for d2lnxa_:

Click to download the PDB-style file with coordinates for d2lnxa_.
(The format of our PDB-style files is described here.)

Timeline for d2lnxa_: